Presentasjon lastes. Vennligst vent

Presentasjon lastes. Vennligst vent

Variantvurdering, rapportering og RNA analyser Kristian Tveten (Telemark) Bjørn Ivar Haukanes (Haukeland) Hilde Monica Stensland (UNN) Liss Anne Solberg.

Liknende presentasjoner


Presentasjon om: "Variantvurdering, rapportering og RNA analyser Kristian Tveten (Telemark) Bjørn Ivar Haukanes (Haukeland) Hilde Monica Stensland (UNN) Liss Anne Solberg."— Utskrift av presentasjonen:

1 Variantvurdering, rapportering og RNA analyser Kristian Tveten (Telemark) Bjørn Ivar Haukanes (Haukeland) Hilde Monica Stensland (UNN) Liss Anne Solberg Lavik (St Olav) Christa Schmidt (St Olav) Helge Rootvelt (OUS) Mari Ann Kulseth (OUS)

2 Klassifisering av varianter Klasse 5: Sykdomsgivende variant Klasse 4: Sannsynlig sykdomsgivende variant Klasse 3: Variant med usikker betydning(VUS) Klasse 2: Sannsynlig normalvariant Klasse 1: Normalvariant

3 Samler fakta om en variant for deretter å vekte hver fakta etter styrke for pathogenisitet eller for normalitet. Summen av vekting avgjør klasse. Richards et al Genetics in Medicine 17; 405

4 Veldig sterk evidens PVS1 Nullvariant (nonsens, frameshift, ±1 el 2 spleisesete, startkodon, eksondelesjon) i gener hvor LOF er kjent sykdomsmekanisme Sterk evidens PS1 Samme aminosyreendring er tidligere etablert som pathogen variant PS2 De novo (foreldreskap er bekreftet) i en pasient med en sykdom uten familiehistorie PS3 In vitro/in vivo funksjonelle studier viser en ødeleggende effekt på mRNA eller protein PS4 Prevalens av variant i affekterte individer er signifikant høyere enn i kontroller Moderat evidens PM1 Lokalisert i mutasjons hotspot og/eller i et kritisk og dokumentert funksjonelt domene i proteinet (f.eks., aktivt sete i et enzym) uten påviste normalvarianter PM2 Ikke påvist i kontrollpopulasjon (eller med svært lav frekvens ved recessiv arvegang) PM3 For recessive tilstander, detektert i trans med en pathogen variant. PM4 Proteinlengden endres, in-frame del/ins i et ikke-repetert område eller ved tap av stoppkodon PM5 En missens som gir en ny aminosyreendring i et kodon hvor en annen aminosyreendring er tidligere rapportert pathogen variant PM6 Antatt de novo (foreldreskap ikke bekreftet) Støttende evidens PP1 Ko-segregering med sykdom i flere affiserte familiemedlemmer PP2Missens-variant i et gen med få normale missens-varianter og hvor missens-varianter er vanlig årsak til sykdom PP3 In silico evidens for pathogenisitet PP4 Pasientens fenotype eller familiehistorie er spesifikk for en sykdom knyttet til et gitt gen PP5Anerkjent kilde har nylig rapportert varianten som pathogen uten tilgjengelig bevis Evidens for pathogenisitet

5 PS2/PM6:Påvist å være de novo Foreldreskap testet Foreldreskap ikke testet Sterk Moderat Støttende PM1:Lokalisert i kritiske og/ eller kjente funksjonelle domener Kjente kritiske aminosyrer i kjente domener *. Lokalisert i kjent funksjonelt viktig domene PM5: Ny missens som endrer en aminosyre som tidligere er rapportert som sykdomsgivende Like dramatisk endring i aminosyre Mindre dramatisk endring i aminosyre PS4: Rapportert i pasienter med samme fenotype* >= 4 ubesl. pasienter 3 ubesl. pasienter 1 – 2 ubesl. pasienter * Ikke observert i ExAc PP1: Ko-segregering* med sykdom Flere ubeslektede familier En familie * Kosegeregering krever 6 meioser i en familie PM2:Ikke påvist i kontroll-populasjon Etnisk tilpasset kontroll-populasjon ExAc

6 Sterk nok alene BA1 Allelfrekvensen er større enn 5% i ESP, 1000Genome, eller ExAc Vi benytter >0,5% ved dominant arvegang, >1% ved recessiv arvegang (noen kjente unntak) Sterk evidens BS1 Allelfrekvensen er større enn forventet for sykdommen Pasienter med alvorlig infantil sykdom skal ikke være inkludert i ExAC. BS2 Påvist i friske voksne individer; for recessive (homozygote), dominante (heterozygote), eller X-bundet(hemizygote) sykdommer med full penetrans forventet i ung alder BS3 In vitro / in vivo funksjonelle studier viser ingen ødeleggende effekt på mRNA eller protein BS4 Manglende segregering i affiserte familiemedlemmer Støttende evidens BP1 Missens-variant i et gen hvor primært nullvarianter er kjent årsak til sykdom BP2 Påvist i trans med en patogen variant i gener forbundet med dominant arvegang, eller uavhengig av arvegang, påvist i cis med en annen pathogen variant BP3 In-frame del/ins i en repetitiv region uten kjent funksjon BP4 In silico evidens støtter ikke pathogenisitet BP5 Variant funnet i en pasient med en annen molekylær forklaring på sykdommen BP6 Anerkjent kilde har nylig rapportert varianten som benign uten tilgjengelig bevis BP7 En synonym variant hvor spleiseprediksjon verken viser noen effekt på konsensus spleisesete eller dannelse av nytt spleisesete. Nukleotiden er heller ikke høyt konservert Evidens for normalitet

7 Pathogen (Klasse 5) 1 veldig sterk + ≥ 1 sterk + ≥ 2 moderate + 1 moderat + 1 støttende + ≥ 2 støttende ≥ 2 sterk 1 sterk + ≥ 3 moderate + 2 moderate + ≥ 2 støttende + 1 moderat + ≥ 4 støttende Pathogen (Klasse 5) 1 veldig sterk + ≥ 1 sterk + ≥ 2 moderate + 1 moderat + 1 støttende + ≥ 2 støttende ≥ 2 sterk 1 sterk + ≥ 3 moderate + 2 moderate + ≥ 2 støttende + 1 moderat + ≥ 4 støttende Sannsynlig pathogen (klasse 4) 1 veldig sterk + 1 moderat 1 sterk moderate + ≥ 2 støttende ≥ 3 moderate 2 moderat + ≥ 2 støttende 1 moderat + ≥ 4 støttende Sannsynlig pathogen (klasse 4) 1 veldig sterk + 1 moderat 1 sterk moderate + ≥ 2 støttende ≥ 3 moderate 2 moderat + ≥ 2 støttende 1 moderat + ≥ 4 støttende Normalvariant (klasse 1) 1 sterk nok alene ≥ 2 sterk Normalvariant (klasse 1) 1 sterk nok alene ≥ 2 sterk Sannsynlig normalvariant (klasse 2): 1 sterk + 1 støttende ≥ 2 støttende Sannsynlig normalvariant (klasse 2): 1 sterk + 1 støttende ≥ 2 støttende Veldig sterk (PVS1) Sterk (PS1-PS4) Moderat (PM1-PM6) Støttende (PP1-PP5) Sterk nok alene (BA1) Strek (BS1-BS4) Støttende (BP1-BP7)

8 Eksempler……

9 NM_ (DYRK1A):c.1309C>T, p.Arg437* Ingen frekvens i ExAc Nonsens i ekson 11 (totalt 13)  NMD LOF er kjent årsak til sykdom Rapportert i en pasient med syndromal ID (foreldre ikke testet) DYRK1A er forbundet med autosomal dominant nedarvet Mental retardation type 7 (OMIM#614104) FaktastyrkePunktBeskrivelse Ingen frekvens i ExAcstøttendePM2* Ikke påvist i kontrollpopulasjon Nonsens med kjent LOF årsak til sykdom Veldig sterkPVS1Nullvariant Rapportert i en pasient med syndromal ID ModeratPS4*Rapportert i pasienter 1 Veldig sterk + 1 moderat + 1 støttende = Klasse 5 (sykdomsgivende)

10 NM_ (TGFB2):c.904C>T, p.Arg302Cys TGFB2 er forbundet med dominant nedarvet Loeys-Dietz syndrom 4 (aorta aneurisme) Ingen frekvens i ExAc Rapportert i to pasienter med aorta aneurisme Konservert aminosyre (ortholog) Menneske 301 KNSGKTPHLLLMLLPSYRLESQQTNRRKKRALDAAYCFRNVQDNCCLRPL 350 Chimpanse 301 KNSGKTPHLLLMLLPSYRLESQQTNRRKKRALDAAYCFRNVQDNCCLRPL 350 Ape 301 KNSGKTPHLLLMLLPSYRLESQQTNRRKKRALDAAYCFRNVQDNCCLRPL 350 Hund 301 KNSGKTPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPL 350 Storfe 273 KNSGKSPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPL 322 Mus 273 KTSGKTPHLLLMLLPSYRLESQQSSRRKKRALDAAYCFRNVQDNCCLRPL 322 Rotte 301 KSSGKTPHLLLMLLPSYRLESQQSSRRRKRALDAAYCFRNVQDNCCLRPL 350 Kylling 271 KYSGKTPHLLLMLLPSYRLESQQPSRRKKRALDAAYCFRNVQDNCCLRPL 320 Zebrafisk 270 RHSGQSPHLLLMLLPSYRLESQHKSHRQKRALDTAFCSRNVQDNRCLRSL 319 Frosk 270 KHTGRTPHLLLMLLPSYRLESQQSSRRKKRALDAAYCFRNVQDNCCLRPL 319

11 Ingen frekvens i ExAc Rapportert i to pasienter med aorta aneurisme Konservert aminosyre Konservert i TGFB1 og TGFB3 (paralog) TGFB2 PSYRLESQ-QTNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANF 345 TGFB1 PLERAQH--LQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANF 321 TGFB3 PPHRLDNPGQGGQRKKRALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANF 343 * * : *::****: ***. :.***:* *****::******:****** *** NM_ (TGFB2):c.904C>T, p.Arg302Cys TGFB2 er forbundet med dominant nedarvet Loeys-Dietz syndrom 4 (aorta aneurisme)

12 Ingen frekvens i ExAc Rapportert i en pasient med aorta aneurisme Konservert aminosyre Konservert i TGFB1 og TGFB2 Lokalisert i et RKKR (RXXR) motiv (spaltesete for furin, dannelse av moden TGFB) TGFB2 PSYRLESQ-QTNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANF 345 TGFB1 PLERAQH--LQSSRHRRALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANF 321 TGFB3 PPHRLDNPGQGGQRKKRALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANF 343 * * : *::****: ***. :.***:* *****::******:****** *** Ingen frekvensdata i ExAc i RXXR motivet NM_ (TGFB2):c.904C>T, p.Arg302Cys TGFB2 er forbundet med dominant nedarvet Loeys-Dietz syndrom 4 (aorta aneurisme)

13 FaktastyrkePunktBeskrivelse Ingen frekvens i ExAcstøttendePM2* Ikke påvist i kontrollpopulasjon Rapportert i to pasienter med aorta aneurisme moderatPS4*Rapportert i pasienter Ortolog og paralog konservet aminosyre støttendePP3In silico evidens for pathogenisitet Lokalisert i et RKKR (RXXR) motiv Spaltesete for furin moderatPM1Lokalisert i mutasjons hotspot og/eller i et kritisk og dokumentert funksjonelt domene i proteinet uten påviste normalvarianter. Variant i tilsvarende aa i TGFB3 er funnet å være sykdomsgivende NM_ (TGFB2):c.904C>T, p.Arg302Cys TGFB2 er forbundet med dominant nedarvet Loeys-Dietz syndrom 4 (aorta aneurisme) 2 moderate + 2 støttende = Klasse 4 (sannsynlig sykdomsgivende)

14

15 NM_ (COL1A2): c.838G>A (p.Gly280Ser) Col1A2 er forbundet med autosomal dominant nedarvet osteogenesis imperfecta (OI) 1) Ingen frekvensdata i ExAc 2) Rapportert i 7 pasienter med OI (Marini et al, 2007) Rapportert nyoppstått i 1 pasient med OI (Lindahl et al, 2015). Foreldreskap ikke testet. Rapportert i 2 pasienter med OI (Roschger et al., 2008) 3) Konservert i alle arter og i trippelheliks i andre kollagener 4) Endrer en Glycin i Gly-X-Y repeat i trippelhelix av collagen type I. 80% av sykdomsgivende varianter i Col1A1 og Col1A2 endrer en Glycin i Gly-X-Y repeat 5) En annen variant i samme kodon (Gly280Val) er rapportert i en pasient med OI (Obafemi et al, 2008)

16 NM_ (SCN1A):c.557T>C (p.Leu186Pro) 1)Ikke rapportert i ExAc eller andre databaser 2)Ikke tidligere rapportert i pasienter 3)Ortholog konservering: Menneske 150 PPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDFTVIT 199 Chimpanse 150 PPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDFTVIT 199 Ape 150 PPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDFTVIT 199 Hund 150 PPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDFTVIT 199 Storfe 150 PPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDFTVIT 199 Mus 150 PPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDFTVIT 199 Rotte 150 PPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDFTVIT 199 Kylling 151 PPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDFTVIT 200 *** * 4 ) Leu186 er lokalisert i cytoplasmatisk loop mellom S2 og S3 i D1 * Rapportert sykdomsgivende varianter Ingen funn i ExAc og dbSNP i denne regionen 5) Analysering av DNA fra foreldrene viste at varianten var nyoppstått (foreldreskap ikke testet) SCN2A SLIKILARGFCLEDFTFLRDPWNW SCN4A SLIKILARGFCVDDFTFLRDPWNW SCN9A SLVKILARGFCVGEFTFLRDPWNW SCN5A SLVKILARGFCLHAFTFLRDPWNW SCN1A SLIKIIARGFCLEDFTFLRDPWNW SCN3A SLIKILARGFCLEDFTFLRDPWNW SCN8A SLVKIIARGFCIDGFTFLRDPWNW SCN11A ALIKILARGFILDEFSFLRDPWNW SCN10A ALIKILARGFCLNEFTYLRDPWNW ***:: *::*** Paralog homologi SCN1A er forbundet med autosomal dominant nedarvet Dravet syndrom (epilepsi) * Rapportert sykdomsgivende varianter

17 NM_ (SCN1A):c.557T>C (p.Leu186Pro) 1)Ikke rapportert i ExAc eller andre databaser 2)Ikke tidligere rapportert i pasienter 3)Ortholog konservering: Menneske 150 PPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDFTVIT 199 Chimpanse 150 PPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDFTVIT 199 Ape 150 PPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDFTVIT 199 Hund 150 PPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDFTVIT 199 Storfe 150 PPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDFTVIT 199 Mus 150 PPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDFTVIT 199 Rotte 150 PPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDFTVIT 199 Kylling 151 PPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDFTVIT 200 *** * 4 ) Leu186 er lokalisert i cytoplasmatisk loop mellom S2 og S3 i D1 * Rapportert sykdomsgivende varianter Ingen funn i ExAc og dbSNP i denne regionen 5) Analysering av DNA fra foreldrene viste at varianten var nyoppstått (foreldreskap ikke testet) SCN2A SLIKILARGFCLEDFTFLRDPWNW SCN4A SLIKILARGFCVDDFTFLRDPWNW SCN9A SLVKILARGFCVGEFTFLRDPWNW SCN5A SLVKILARGFCLHAFTFLRDPWNW SCN1A SLIKIIARGFCLEDFTFLRDPWNW SCN3A SLIKILARGFCLEDFTFLRDPWNW SCN8A SLVKIIARGFCIDGFTFLRDPWNW SCN11A ALIKILARGFILDEFSFLRDPWNW SCN10A ALIKILARGFCLNEFTYLRDPWNW ***:: *::*** Paralog homologi SCN1A er forbundet med autosomal dominant nedarvet Dravet syndrom (epilepsi) * Rapportert sykdomsgivende varianter

18 FaktastyrkePunktBeskrivelse Ingen frekvens i ExAcstøttendePM2* Ikke påvist i kontrollpopulasjon Rapportert i 9 pasienter med OIsterkPS4Rapportert i pasienter Rapportert nyoppstått i 1 pasient med OI (foreldreskap ikke testet) moderatPS2*De novo variant Konservert i andre arter og i trippelhelix i andre kollagener støttendePP3In silico evidens Endrer en Gly i Gly-X-Y i trippelhelix moderatPM1Lokalisert i mutasjons hotspot og/eller i et kritisk og dokumentert funksjonelt domene En annen variant i samme kodon (Gly280Val) er rapportert i 1 pasient støttendePM5*Annen variant i samme kodon NM_ (COL1A2): c.838G>A (p.Gly280Ser)

19 FaktastyrkePunktBeskrivelse Ingen frekvens i ExAcstøttendePM2* Ikke påvist i kontrollpopulasjon Rapportert i 9 pasienter med OIsterkPS4Rapportert i pasienter Rapportert nyoppstått i 1 pasient med OI (foreldreskap ikke testet) moderatPS2*De novo variant Konservert i andre arter og i trippelhelix i andre kollagener støttendePP3In silico evidens Endrer en Gly i Gly-X-Y i trippelhelix moderatPM1Lokalisert i mutasjons hotspot og/eller i et kritisk og dokumentert funksjonelt domene En annen variant i samme kodon (Gly280Val) er rapportert i 1 pasient støttendePM5*Annen variant i samme kodon NM_ (COL1A2): c.838G>A (p.Gly280Ser)

20 FaktastyrkePunktBeskrivelse Ingen frekvens i ExAcstøttendePM2* Ikke påvist i kontrollpopulasjon Rapportert i 9 pasienter med OIsterkPS4Rapportert i pasienter Rapportert nyoppstått i 1 pasient med OI (foreldreskap ikke testet) moderatPS2*De novo variant Konservert i andre arter og i trippelhelix i andre kollagener støttendePP3In silico evidens Endrer en Gly i Gly-X-Y i trippelhelix moderatPM1Lokalisert i mutasjons hotspot og/eller i et kritisk og dokumentert funksjonelt domene En annen variant i samme kodon (Gly280Val) er rapportert i 1 pasient støttendePM5*Annen variant i samme kodon NM_ (COL1A2): c.838G>A (p.Gly280Ser)

21 FaktastyrkePunktBeskrivelse Ingen frekvens i ExAcstøttendePM2* Ikke påvist i kontrollpopulasjon Rapportert i 9 pasienter med OIsterkPS4Rapportert i pasienter Rapportert nyoppstått i 1 pasient med OI (foreldreskap ikke testet) moderatPS2*De novo variant Konservert i andre arter og i trippelhelix i andre kollagener støttendePP3In silico evidens Endrer en Gly i Gly-X-Y i trippelhelix moderatPM1Lokalisert i mutasjons hotspot og/eller i et kritisk og dokumentert funksjonelt domene En annen variant i samme kodon (Gly280Val) er rapportert i 1 pasient støttendePM5*Annen variant i samme kodon NM_ (COL1A2): c.838G>A (p.Gly280Ser)

22 FaktastyrkePunktBeskrivelse Ingen frekvens i ExAcstøttendePM2* Ikke påvist i kontrollpopulasjon Rapportert i 9 pasienter med OIsterkPS4Rapportert i pasienter Rapportert nyoppstått i 1 pasient med OI (foreldreskap ikke testet) moderatPS2*De novo variant Konservert i andre arter og i trippelhelix i andre kollagener støttendePP3In silico evidens Endrer en Gly i Gly-X-Y i trippelhelix moderatPM1Lokalisert i mutasjons hotspot og/eller i et kritisk og dokumentert funksjonelt domene En annen variant i samme kodon (Gly280Val) er rapportert i 1 pasient støttendePM5*Annen variant i samme kodon NM_ (COL1A2): c.838G>A (p.Gly280Ser)

23 FaktastyrkePunktBeskrivelse Ingen frekvens i ExAcstøttendePM2* Ikke påvist i kontrollpopulasjon Rapportert i 9 pasienter med OIsterkPS4Rapportert i pasienter Rapportert nyoppstått i 1 pasient med OI (foreldreskap ikke testet) moderatPS2*De novo variant Konservert i andre arter og i trippelhelix i andre kollagener støttendePP3In silico evidens Endrer en Gly i Gly-X-Y i trippelhelix moderatPM1Lokalisert i mutasjons hotspot og/eller i et kritisk og dokumentert funksjonelt domene En annen variant i samme kodon (Gly280Val) er rapportert i 1 pasient støttendePM5*Annen variant i samme kodon NM_ (COL1A2): c.838G>A (p.Gly280Ser)

24 FaktastyrkePunktBeskrivelse Ingen frekvens i ExAcstøttendePM2* Ikke påvist i kontrollpopulasjon Rapportert i 9 pasienter med OIsterkPS4Rapportert i pasienter Rapportert nyoppstått i 1 pasient med OI (foreldreskap ikke testet) moderatPS2*De novo variant Konservert i andre arter og i trippelhelix i andre kollagener støttendePP3In silico evidens Endrer en Gly i Gly-X-Y i trippelhelix moderatPM1Lokalisert i mutasjons hotspot og/eller i et kritisk og dokumentert funksjonelt domene En annen variant i samme kodon (Gly280Val) er rapportert i 1 pasient støttendePM5*Annen variant i samme kodon NM_ (COL1A2): c.838G>A (p.Gly280Ser) 1 sterk +2 moderat + 3 støttende = Sykdomsgivende (Klasse 5)

25 NM_ (SCN1A):c.557T>C (p.Leu186Pro) FaktastyrkePunktBeskrivelse Ingen frekvens i ExAcstøttendePM2* Ikke påvist i kontrollpopulasjon Konservert i andre arter og i proteinfamilien støttendePP3In silico evidens Lokalisert i et definert område med flere mutasjoner og ingen normalvarianter (S2 - S3 linker) moderatPM1 Lokalisert i mutasjons hotspot og/eller i et kritisk og dokumentert funksjonelt domene Påvist de novo hos vår pasient (foreldreskap ikke testet) moderatPS2*De novo variant

26 NM_ (SCN1A):c.557T>C (p.Leu186Pro) FaktastyrkePunktBeskrivelse Ingen frekvens i ExAcstøttendePM2* Ikke påvist i kontrollpopulasjon Konservert i andre arter og i proteinfamilien støttendePP3In silico evidens Lokalisert i et definert område med flere mutasjoner og ingen normalvarianter (S2 - S3 linker) moderatPM1 Lokalisert i mutasjons hotspot og/eller i et kritisk og dokumentert funksjonelt domene Påvist de novo hos vår pasient (foreldreskap ikke testet) moderatPS2*De novo variant

27 NM_ (SCN1A):c.557T>C (p.Leu186Pro) FaktastyrkePunktBeskrivelse Ingen frekvens i ExAcstøttendePM2* Ikke påvist i kontrollpopulasjon Konservert i andre arter og i proteinfamilien støttendePP3In silico evidens Lokalisert i et definert område med flere mutasjoner og ingen normalvarianter (S2 - S3 linker) moderatPM1 Lokalisert i mutasjons hotspot og/eller i et kritisk og dokumentert funksjonelt domene Påvist de novo hos vår pasient (foreldreskap ikke testet) moderatPS2*De novo variant

28 NM_ (SCN1A):c.557T>C (p.Leu186Pro) FaktastyrkePunktBeskrivelse Ingen frekvens i ExAcstøttendePM2* Ikke påvist i kontrollpopulasjon Konservert i andre arter og i proteinfamilien støttendePP3In silico evidens Lokalisert i et definert område med flere mutasjoner og ingen normalvarianter (S2 - S3 linker) moderatPM1 Lokalisert i mutasjons hotspot og/eller i et kritisk og dokumentert funksjonelt domene Påvist de novo hos vår pasient (foreldreskap ikke testet) moderatPS2*De novo variant

29 NM_ (SCN1A):c.557T>C (p.Leu186Pro) FaktastyrkePunktBeskrivelse Ingen frekvens i ExAcstøttendePM2* Ikke påvist i kontrollpopulasjon Konservert i andre arter og i proteinfamilien støttendePP3In silico evidens Lokalisert i et definert område med flere mutasjoner og ingen normalvarianter (S2 - S3 linker) moderatPM1 Lokalisert i mutasjons hotspot og/eller i et kritisk og dokumentert funksjonelt domene Påvist de novo hos vår pasient (foreldreskap ikke testet) moderatPS2*De novo variant

30 2 Moderat + 2 støttende = Klasse 4 (sannsynlig sykdomsgivende) NM_ (SCN1A):c.557T>C (p.Leu186Pro) FaktastyrkePunktBeskrivelse Ingen frekvens i ExAcstøttendePM2* Ikke påvist i kontrollpopulasjon Konservert i andre arter og i proteinfamilien støttendePP3In silico evidens Lokalisert i et definert område med flere mutasjoner og ingen normalvarianter (S2 - S3 linker) moderatPM1 Lokalisert i mutasjons hotspot og/eller i et kritisk og dokumentert funksjonelt domene Påvist de novo hos vår pasient (foreldreskap ikke testet) moderatPS2*De novo variant


Laste ned ppt "Variantvurdering, rapportering og RNA analyser Kristian Tveten (Telemark) Bjørn Ivar Haukanes (Haukeland) Hilde Monica Stensland (UNN) Liss Anne Solberg."

Liknende presentasjoner


Annonser fra Google